Human Monoclonal Antibody For Hedches
Monoclonal antibody for SUR1 and SUR2B |
|||
| SMC-432D | Stressmarq | 0.1mg | EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
|||
Human Antibody Laboratories manufactures the human monoclonal antibody for hedches reagents distributed by Genprice. The Human Monoclonal Antibody For Hedches reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody For
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 472.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-DY594 | Stressmarq | 0.1mg | EUR 472.8 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with Dylight 594. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-DY633 | Stressmarq | 0.1mg | EUR 466.8 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with Dylight 633. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-FITC | Stressmarq | 0.1mg | EUR 469.2 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with FITC. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-HRP | Stressmarq | 0.1mg | EUR 464.4 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with HRP. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-P594 | Stressmarq | 0.1mg | EUR 487.2 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with PE/ATTO 594. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-PCP | Stressmarq | 0.1mg | EUR 477.6 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with PerCP. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-RPE | Stressmarq | 0.1mg | EUR 475.2 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with RPE. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492D-STR | Stressmarq | 0.1mg | EUR 476.4 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with Streptavidin. |
|||
Monoclonal antibody for Kv3.2 |
|||
| SMC-492S | Stressmarq | 0.012mg | EUR 78 |
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is not conjugated. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-A565 | Stressmarq | 0.1mg | EUR 417.6 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 565. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-A633 | Stressmarq | 0.1mg | EUR 417.6 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 633. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-A655 | Stressmarq | 0.1mg | EUR 417.6 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 655. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-A680 | Stressmarq | 0.1mg | EUR 417.6 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 680. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-A700 | Stressmarq | 0.1mg | EUR 417.6 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with ATTO 700. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-APCCY7 | Stressmarq | 0.1mg | EUR 502.8 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with APC/Cy7. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-DY350 | Stressmarq | 0.1mg | EUR 434.4 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 350. |
|||
Monoclonal antibody for p23 |
|||
| SMC-156D-DY405 | Stressmarq | 0.1mg | EUR 421.2 |
|
Description: A monoclonal antibody from clone JJ6 against Human | Mouse | Rat | Bovine p23. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant human full length p23 protein. The antibody is tested and validated for WB, IHC, ICC/IF, IP, ELISA, AM assays with the following recommended dilutions: WB (1:2000) IHC (1:100), ICC/IF (1:100). This MAb for p23 is conjugated with Dylight 405. |
|||