Human Monoclonal Antibody For Hedches

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the human monoclonal antibody for hedches reagents distributed by Genprice. The Human Monoclonal Antibody For Hedches reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody For

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

Antibody For information

Monoclonal antibody for Kv3.2

SMC-492D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with RPE.

Monoclonal antibody for Kv3.2

SMC-492D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with Streptavidin.

Monoclonal antibody for Kv3.2

SMC-492S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is not conjugated.

Monoclonal antibody for GST

SMC-549D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with ATTO 565.

Monoclonal antibody for GST

SMC-549D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with ATTO 633.

Monoclonal antibody for GST

SMC-549D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with ATTO 655.

Monoclonal antibody for GST

SMC-549D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with ATTO 680.

Monoclonal antibody for GST

SMC-549D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with ATTO 700.

Monoclonal antibody for GST

SMC-549D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with APC/Cy7.

Monoclonal antibody for GST

SMC-549D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with Dylight 350.

Monoclonal antibody for GST

SMC-549D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with Dylight 405.

Monoclonal antibody for GST

SMC-549D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with Dylight 488.

Monoclonal antibody for GST

SMC-549D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with Dylight 594.

Monoclonal antibody for GST

SMC-549D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with Dylight 633.

Monoclonal antibody for GST

SMC-549D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with PE/ATTO 594.

Monoclonal antibody for GST

SMC-549D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone 3E2 against Human GST. The host species for the production of this antibody is Mouse. The antigen used for immunization is Schistosoma japonicum Glutathione-S-Transferase (GST) tagged protein. The antibody is tested and validated for WB, ELISA assays with the following recommended dilutions: WB (1:1000); ELISA (1:800). This MAb for GST is conjugated with Streptavidin.

Monoclonal antibody for Tau

SMC-607D-A565 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 565.