Human Monoclonal Antibody For Cholesterol
Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the human monoclonal antibody for cholesterol reagents distributed by Genprice. The Human Monoclonal Antibody For Cholesterol reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody For
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 477.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 564 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 474 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 495.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 482.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 470.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 472.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Antibody For information
HRP Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2137650-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
APC_Cy7 Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2137644-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
FITC Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2137649-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
PE-Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2081335-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
APC-Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2081338-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Cy3-Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2081341-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
HRP-Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2081347-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Biotin Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2137648-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
FITC-Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2081344-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Biotin-Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2091250-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
APC/CY7-Linked Monoclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT) |
|
MBS2081332-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Cholesterol Antibody |
|
abx100311-100l |
Abbexa |
100 µl |
EUR 287.5 |
Cholesterol Antibody |
|
abx100311-1ml |
Abbexa |
1 ml |
EUR 850 |
Cholesterol Antibody |
|
abx100311-200l |
Abbexa |
200 µl |
EUR 375 |
ELISA kit for Human CH25H (Cholesterol-25-Hydroxylase) |
|
ELK3800 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
|
|
Description: A sandwich ELISA kit for detection of Cholesterol-25-Hydroxylase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA Kit for Cholesterol (CH) |
|
CEB701Ge |
Cloud-Clone |
96Т |
EUR 870 |
|
|
Cholesterol (CH) Antibody |
|
20-abx100311 |
Abbexa |
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
-
Ask for price
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
|
