Human Monoclonal Antibody For Osteoporosis
Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Antibody Laboratories manufactures the human monoclonal antibody for osteoporosis reagents distributed by Genprice. The Human Monoclonal Antibody For Osteoporosis reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody For
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 477.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 564 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 474 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 495.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 482.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 470.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 472.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Antibody For information
Monoclonal Antibody to Osteopontin (OPN) |
|
MAA899Hu22 |
Cloud-Clone |
100ul |
EUR 203 |
|
|
Monoclonal Antibody to Osteopontin (OPN) |
|
MAA899Po21 |
Cloud-Clone |
100ul |
EUR 279 |
|
|
Monoclonal Antibody to Osteopontin (OPN) |
|
MAA899Po22 |
Cloud-Clone |
100ul |
EUR 286 |
|
|
Monoclonal Antibody to Osteopontin (OPN) |
|
MAA899Po23 |
Cloud-Clone |
100ul |
EUR 286 |
|
|
Monoclonal Antibody to Osteopontin (OPN) |
|
MAA899Po24 |
Cloud-Clone |
100ul |
EUR 286 |
|
|
Monoclonal Antibody to Osteopontin (OPN) |
|
MBS2138798-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Osteopontin monoclonal antibody (87-B) |
|
MBS565829-01mg |
MyBiosource |
0.1mg |
EUR 425 |
Osteopontin monoclonal antibody (87-B) |
|
MBS565829-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1875 |
Osteopontin Rabbit Monoclonal Antibody |
|
E10G22207 |
EnoGene |
100 μl |
EUR 275 |
|
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody |
Osteopontin Conjugated Monoclonal Antibody |
|
C42036 |
SAB |
100ul |
EUR 476.4 |
Osteopontin Conjugated Monoclonal Antibody |
|
MBS9450481-01mLAF350 |
MyBiosource |
0.1mL(AF350) |
EUR 480 |
Osteopontin Conjugated Monoclonal Antibody |
|
MBS9450481-01mLAF405 |
MyBiosource |
0.1mL(AF405) |
EUR 480 |
Osteopontin Conjugated Monoclonal Antibody |
|
MBS9450481-01mLAF488 |
MyBiosource |
0.1mL(AF488) |
EUR 480 |
Osteopontin Conjugated Monoclonal Antibody |
|
MBS9450481-01mLAF555 |
MyBiosource |
0.1mL(AF555) |
EUR 480 |
Osteopontin Conjugated Monoclonal Antibody |
|
MBS9450481-01mLBiotin |
MyBiosource |
0.1mL(Biotin) |
EUR 480 |
Mouse monoclonal Osteopontin antibody |
|
MBS5306952-01mg |
MyBiosource |
0.1mg |
EUR 670 |
Mouse monoclonal Osteopontin antibody |
|
MBS5306952-5x01mg |
MyBiosource |
5x0.1mg |
EUR 2875 |
