Human Monoclonal Antibody For Cholesterol

Monoclonal antibody for SUR1 and SUR2B
SMC-432D	Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the human monoclonal antibody for cholesterol reagents distributed by Genprice. The Human Monoclonal Antibody For Cholesterol reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody For

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

Antibody For information

Cholesterol Oxidase (choD) Antibody
20-abx110608	Abbexa	Ask for price Ask for price Ask for price Ask for price Ask for price	100 ug 1 mg 200 ug 20 ug 50 ug

Cholesterol oxidase Antibody (FITC)
20-abx107751	Abbexa	Ask for price Ask for price Ask for price Ask for price Ask for price	100 ug 1 mg 200 ug 20 ug 50 ug

Cholesterol (CH) Polyclonal Antibody
CAU25467-100ul	Biomatik Corporation	100ul	EUR 267.8

Cholesterol (CH) Polyclonal Antibody
CAU25467-200ul	Biomatik Corporation	200ul	EUR 334.3

ELISA kit for Human CH25H (Cholesterol-25-Hydroxylase)
ELK3800	ELK Biotech	1 plate of 96 wells	EUR 518.4
Description: A sandwich ELISA kit for detection of Cholesterol-25-Hydroxylase from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Cholesterol oxidase Antibody (Biotin)
20-abx106338	Abbexa	Ask for price Ask for price Ask for price Ask for price Ask for price	100 ug 1 mg 200 ug 20 ug 50 ug

Monoclonal Antibody to Cholesteryl Ester Transfer Protein (CETP)
MAA814Hu22	Cloud-Clone	100ul	EUR 235

Cholesterol Oxidase (CHOD) Antibody (HRP)
20-abx300142	Abbexa	Ask for price Ask for price Ask for price Ask for price Ask for price	100 ug 1 mg 200 ug 20 ug 50 ug

ELISA kit for Fish Cholesterol (CH)
KTE40026-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Fish Cholesterol (CH) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Fish Cholesterol (CH)
KTE40026-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Fish Cholesterol (CH) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Fish Cholesterol (CH)
KTE40026-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Fish Cholesterol (CH) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Polyclonal Antibody to Cholesterol (CH)
PAB701Ge01	Cloud-Clone	100ul	EUR 279

Cholesterol Oxidase (CHOD) Antibody (FITC)
20-abx300143	Abbexa	Ask for price Ask for price Ask for price Ask for price Ask for price	100 ug 1 mg 200 ug 20 ug 50 ug

Cholesterol-25-Hydroxylase (CH25H) Antibody
20-abx175842	Abbexa	Ask for price Ask for price	1 mg 200 ug

Cholesterol-25-Hydroxylase (CH25H) Antibody
20-abx171719	Abbexa	Ask for price Ask for price	1 mg 200 ug

Cholesterol Oxidase (CHOD) Antibody (Biotin)
20-abx300144	Abbexa	Ask for price Ask for price Ask for price Ask for price Ask for price	100 ug 1 mg 200 ug 20 ug 50 ug

Human Neutral Cholesterol Ester Hydrolase 1 (NCEH1) Antibody
35747-05111	AssayPro	150 ug	EUR 215