Cytopoint Injection-Monoclonal Antibody For Dogs

C-Peptide, dogs
5-00880 4 x 1mg Ask for price

Dog Antibody Laboratories manufactures the cytopoint injection-monoclonal antibody for dogs reagents distributed by Genprice. The Cytopoint Injection-Monoclonal Antibody For Dogs reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact dog Antibody. Other Cytopoint products are available in stock. Specificity: Cytopoint Category: Injection-Monoclonal Group: Antibody For

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Antibody For information

Femtotip sterile injectioncapillary 0.5um - PK20
F5242952008 PK20
EUR 193.05

Femtotip II sterile injectioncapillary 0.5um - PK20
F5242957000 PK20
EUR 179.55

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is not conjugated.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A390 0.1mg
EUR 480
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 390.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A488 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 488.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 565.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A594 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 594.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 633.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 655.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 680.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with ATTO 700.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-ALP 0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with Alkaline Phosphatase.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-APC 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with APC.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with APC/Cy7.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-BI 0.1mg
EUR 474
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with Biotin.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with Dylight 350.

Monoclonal antibody for LRP4 (Cytoplasmic)
SMC-415D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S164-6 against Trypanosoma brucei brucei LRP4 (Cytoplasmic). The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Fusion protein amino acids 1747-1905 (cytoplasmic C-terminus) of mouse LRP4 . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for LRP4 (Cytoplasmic) is conjugated with Dylight 405.

Site Title, Some rights reserved.

Terms of Use - Privacy Policy

WordPress Di Blog Theme