Igg Monoclonal Antibody And Mgus

immunofixation mgus, mm
EHCA1200-KC09-02 ea
EUR 366

Igg Antibody Laboratories manufactures the igg monoclonal antibody and mgus reagents distributed by Genprice. The Igg Monoclonal Antibody And Mgus reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Monoclonal Group: Antibody And

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Antibody And information

Immunoglobulin G (IgG) Monoclonal Antibody
CAU30642-100ul 100ul
EUR 255.4

Immunoglobulin G (IgG) Monoclonal Antibody
CAU30642-200ul 200ul
EUR 319.2

Mouse Anti Cat Igg Monoclonal Antibody
DMABT-51974MC 0.25 mg
EUR 920.4

Mouse Anti Cat Igg Monoclonal Antibody
DMABT-51975MC 2 ml
EUR 889.2

Human IgG (Isotype Specific) mouse monoclonal antibody, clone NI 335 and NI 343, HRP
AM20258HR-N 200 µg Ask for price

Human IgG Mouse Monoclonal Antibody
E10G20464 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Monoclonal Anti-human IgG antibody.
TMI031-0.25MG 0.25mg
EUR 169
Description: Specific to human IgG, no cross reaction with IgA, IgE, and IgM. This antibody can be paired with TMI032.

Monoclonal Anti-human IgG antibody.
TMI031-1MG 1mg
EUR 569
Description: Specific to human IgG, no cross reaction with IgA, IgE, and IgM. This antibody can be paired with TMI032.

Monoclonal Anti-human IgG antibody.
TMI032-0.25MG 0.25mg
EUR 169
Description: Specific to human IgG, no cross reaction with IgA, IgE, and IgM. This antibody can be paired with TMI031.

Monoclonal Anti-human IgG antibody.
TMI032-1MG 1mg
EUR 569
Description: Specific to human IgG, no cross reaction with IgA, IgE, and IgM. This antibody can be paired with TMI031.

Human IgG (Isotype Specific) mouse monoclonal antibody, clone NI 335 and NI 343, FITC
AM20258FC-N 200 µg Ask for price

Mouse Anti Human Igg Monoclonal Antibody
CABT-48853MH 1 mg
EUR 889.2

Rabbit IgG Mouse Monoclonal Antibody
E10G20626 100 μl
EUR 275
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Human IgG (Isotype Specific) mouse monoclonal antibody, clone NI 335 and NI 343, TRITC
AM20258TC-N 200 µg Ask for price

Mouse Anti Bovine Igg Monoclonal Antibody
DMABT-51902MB 0.25 mg
EUR 889.2

Human IgG (Isotype Specific) mouse monoclonal antibody, clone NI 335 and NI 343, Ascites
AM20258AF-N 500 µg Ask for price

Human IgG (Isotype Specific) mouse monoclonal antibody, clone NI 335 and NI 343, Biotin
AM20258BT-N 200 µg Ask for price

Site Title, Some rights reserved.

Terms of Use - Privacy Policy

WordPress Di Blog Theme