Cd155 Monoclonal Antibody For Elisa
Monoclonal antibody for SUR1 and SUR2B |
|||
| SMC-432D | Stressmarq | 0.1mg | EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
|||
Human IgG antibody Laboratories manufactures the cd155 monoclonal antibody for elisa reagents distributed by Genprice. The Cd155 Monoclonal Antibody For Elisa reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact monoclonal elisa. Other Cd155 products are available in stock. Specificity: Cd155 Category: Monoclonal Group: Antibody For
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
||
Monoclonal antibody for SUR1 and SUR2B |
||
| Stressmarq | 0.1mg | EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
||
Monoclonal antibody for CD45 |
|||
| SMC-256D-DY405 | Stressmarq | 0.1ml | EUR 494.4 |
|
Description: A monoclonal antibody from clone 12A9 against Human | Mouse | Rat CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with Dylight 405. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-DY488 | Stressmarq | 0.1ml | EUR 471.6 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with Dylight 488. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-DY594 | Stressmarq | 0.1ml | EUR 476.4 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with Dylight 594. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-DY633 | Stressmarq | 0.1ml | EUR 464.4 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with Dylight 633. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-HRP | Stressmarq | 0.1ml | EUR 418.8 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with HRP. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-P594 | Stressmarq | 0.1ml | EUR 440.4 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with PE/ATTO 594. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-PCP | Stressmarq | 0.1ml | EUR 430.8 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with PerCP. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-RPE | Stressmarq | 0.1ml | EUR 429.6 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with RPE. |
|||
Monoclonal antibody for CD45 |
|||
| SMC-256D-STR | Stressmarq | 0.1ml | EUR 430.8 |
|
Description: A monoclonal antibody from clone 12A9 against Human CD45. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Purified recombinant fragment of human CD45 expressed in E. Coli. The antibody is tested and validated for WB, IHC assays with the following recommended dilutions: WB (1:1000). This MAb for CD45 is conjugated with Streptavidin. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-A565 | Stressmarq | 0.1ml | EUR 432 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with ATTO 565. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-A633 | Stressmarq | 0.1ml | EUR 432 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with ATTO 633. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-A655 | Stressmarq | 0.1ml | EUR 432 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with ATTO 655. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-A680 | Stressmarq | 0.1ml | EUR 432 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with ATTO 680. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-A700 | Stressmarq | 0.1ml | EUR 432 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with ATTO 700. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-ALP | Stressmarq | 0.1ml | EUR 426 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with Alkaline Phosphatase. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-APC | Stressmarq | 0.1ml | EUR 430.8 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with APC. |
|||
Monoclonal antibody for CD68 |
|||
| SMC-257D-APCCY7 | Stressmarq | 0.1ml | EUR 518.4 |
|
Description: A monoclonal antibody from clone 6F3 against Human CD68. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human A synthesized peptide derived from human CD68. The antibody is tested and validated for IHC assays with the following recommended dilutions: IHC (1:100). This MAb for CD68 is conjugated with APC/Cy7. |
|||