Ace2 Monoclonal Antibody Abcepta
Monoclonal PP2A alpha and beta Antibody |
|
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
|
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Ace2 Monoclonal Laboratories manufactures the ace2 monoclonal antibody abcepta reagents distributed by Genprice. The Ace2 Monoclonal Antibody Abcepta reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact ACE2 Monoclonal. Other Ace2 products are available in stock. Specificity: Ace2 Category: Monoclonal Group: Antibody Abcepta
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 471.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Antibody Abcepta information
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Hu21 |
Cloud-Clone |
100ul |
EUR 210 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Hu22 |
Cloud-Clone |
100ul |
EUR 203 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Hu23 |
Cloud-Clone |
100ul |
EUR 238 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Hu24 |
Cloud-Clone |
100ul |
EUR 238 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Hu25 |
Cloud-Clone |
100ul |
EUR 210 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Ra21 |
Cloud-Clone |
100ul |
EUR 267 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Ra22 |
Cloud-Clone |
100ul |
EUR 274 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Ra23 |
Cloud-Clone |
100ul |
EUR 274 |
|
|
Monoclonal Antibody to Angiotensin I Converting Enzyme 2 (ACE2) |
|
MAB886Ra24 |
Cloud-Clone |
100ul |
EUR 274 |
|
|
