Human Monoclonal Antibody Abbreviazione

Monoclonal PP2A alpha and beta Antibody
AMM03147G	Leading Biology	0.1ml	EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the human monoclonal antibody abbreviazione reagents distributed by Genprice. The Human Monoclonal Antibody Abbreviazione reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Abbreviazione

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Antibody Abbreviazione information

Human CD45RA Monoclonal antibody
45RAPC7-100T	ImmunoStep	100 test	EUR 358.6

Human LAMBDA Monoclonal antibody
LA2-100T	ImmunoStep	100 test	EUR 445.5

FABP2 mouse monoclonal antibody, clone 9A9B7B3, Ascites
AM06397SU-N	Origene Technologies GmbH	100 µl	Ask for price

Human IGF-I monoclonal antibody
MAM1	GroPep	500 µg	EUR 358.8

Human TCR CB1 Monoclonal antibody
JOVIDY634	ImmunoStep	100 test	EUR 611.6

Human TCR CB1 Monoclonal antibody
JOVIF	ImmunoStep	100 test	EUR 463.1

Monoclonal Human IgM Antibody
AMM03207G	Leading Biology	0.1ml	EUR 580.8
Description: A Monoclonal antibody against Human Human IgM. The antibodies are raised in Mouse.

Human TGF-β2 monoclonal antibody
MAB1	GroPep	500 µg	EUR 358.8

Pepsin (PP) Monoclonal Antibody (Human)
4-MAA632Hu22	Cloud-Clone	EUR 310.80 EUR 3249.60 EUR 804.00 EUR 393.60 EUR 262.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Pepsin (PP)

Titin (TTN) Monoclonal Antibody (Human)
4-MAB667Hu21	Cloud-Clone	EUR 260.40 EUR 2457.60 EUR 624.00 EUR 321.60 EUR 241.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Titin (TTN)

Klotho (KL) Monoclonal Antibody (Human)
4-MAH757Hu21	Cloud-Clone	EUR 306.00 EUR 3170.40 EUR 786.00 EUR 386.40 EUR 260.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Klotho (KL)

Human IGFBP-3 monoclonal antibody
MAK1	GroPep	200 µg	EUR 358.8

Zyxin (ZYX) Monoclonal Antibody (Human)
4-MAC235Hu21	Cloud-Clone	EUR 306.00 EUR 3170.40 EUR 786.00 EUR 386.40 EUR 260.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Zyxin (ZYX)

Anti Human HMCN1 Monoclonal Antibody
Y055911	ABM	100 µl	EUR 575

Midkine (MK) Monoclonal Antibody (Human)
4-MAA631Hu22	Cloud-Clone	EUR 289.20 EUR 2900.40 EUR 724.80 EUR 361.20 EUR 253.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Midkine (MK)

Leptin (LEP) Monoclonal Antibody (Human)
4-MAA084Hu21	Cloud-Clone	EUR 285.60 EUR 2845.20 EUR 711.60 EUR 356.40 EUR 252.00	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)

Leptin (LEP) Monoclonal Antibody (Human)
4-MAA084Hu22	Cloud-Clone	EUR 285.60 EUR 2845.20 EUR 711.60 EUR 356.40 EUR 252.00	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)