Human Monoclonal Antibody And Hcg Interference

Monoclonal Anti- α-hCG Antibody.
TMH011-0.25mg	Tribioscience	0.25mg	EUR 169
Description: Isotype: IgG1. This antibody can be paired with THM014, and THM016 for hCG detection.

Human Monoclonal Laboratories manufactures the human monoclonal antibody and hcg interference reagents distributed by Genprice. The Human Monoclonal Antibody And Hcg Interference reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody And

Monoclonal HCG-beta (Pregnancy & Choriocarcinoma Marker) Antibody - With BSA and Azide, Clone: SPM529
Leading Biology	0.05mg	EUR 475.2
Description: A Monoclonal antibody against Human HCG-beta (Pregnancy & Choriocarcinoma Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM529. This antibody is applicable in IHC-P

Monoclonal HCG-beta (Pregnancy & Choriocarcinoma Marker) Antibody - With BSA and Azide, Clone: SPM105
Leading Biology	0.05mg	EUR 475.2
Description: A Monoclonal antibody against Human HCG-beta (Pregnancy & Choriocarcinoma Marker) - With BSA and Azide. The antibodies are raised in Mouse and are from clone SPM105. This antibody is applicable in IHC-P

Monoclonal HCG-beta (Pregnancy & Choriocarcinoma Marker) Antibody - Without BSA and Azide, Clone: SPM529
Leading Biology	0.1mg	EUR 580.8
Description: A Monoclonal antibody against Human HCG-beta (Pregnancy & Choriocarcinoma Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM529. This antibody is applicable in IHC-P

Monoclonal HCG-beta (Pregnancy & Choriocarcinoma Marker) Antibody - Without BSA and Azide, Clone: SPM105
Leading Biology	0.1mg	EUR 580.8
Description: A Monoclonal antibody against Human HCG-beta (Pregnancy & Choriocarcinoma Marker) - Without BSA and Azide. The antibodies are raised in Mouse and are from clone SPM105. This antibody is applicable in IHC-P

Monoclonal Anti-beta-HCG Antibody Antibody
GenWay Biotech	0.1 mg	Ask for price

Monoclonal PP2A alpha and beta Antibody
Leading Biology	0.1ml	EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Antibody And information

ICP Interference Check Standard 18 without Mercury - 500ML
INTER18-500N	Scientific Laboratory Supplies	500ML	EUR 843.75

Rat Systemic RNA interference defective protein 1 ELISA kit
E02S0098-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Rat Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Systemic RNA interference defective protein 1 ELISA kit
E02S0098-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Rat Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Systemic RNA interference defective protein 1 ELISA kit
E02S0098-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Rat Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Systemic RNA interference defective protein 2 ELISA kit
E02S0099-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Rat Systemic RNA interference defective protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Systemic RNA interference defective protein 2 ELISA kit
E02S0099-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Rat Systemic RNA interference defective protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Systemic RNA interference defective protein 2 ELISA kit
E02S0099-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Rat Systemic RNA interference defective protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Systemic RNA interference defective protein 1 ELISA kit
E08S0098-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Systemic RNA interference defective protein 1 ELISA kit
E08S0098-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Canine Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Systemic RNA interference defective protein 1 ELISA kit
E08S0098-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Canine Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Systemic RNA interference defective protein 2 ELISA kit
E08S0099-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine Systemic RNA interference defective protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Systemic RNA interference defective protein 2 ELISA kit
E08S0099-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Canine Systemic RNA interference defective protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Systemic RNA interference defective protein 2 ELISA kit
E08S0099-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Canine Systemic RNA interference defective protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Systemic RNA interference defective protein 1 ELISA kit
E07S0098-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Porcine Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Systemic RNA interference defective protein 1 ELISA kit
E07S0098-48	BlueGene	1 plate of 48 wells	EUR 624
Description: A competitive ELISA for quantitative measurement of Porcine Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Systemic RNA interference defective protein 1 ELISA kit
E07S0098-96	BlueGene	1 plate of 96 wells	EUR 822
Description: A competitive ELISA for quantitative measurement of Porcine Systemic RNA interference defective protein 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Systemic RNA interference defective protein 2 ELISA kit
E07S0099-192T	BlueGene	192 tests	EUR 1524
Description: A competitive ELISA for quantitative measurement of Porcine Systemic RNA interference defective protein 2 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.